PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 30131.m007102
Common NameLOC8284344, RCOM_1449160
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family SRS
Protein Properties Length: 199aa    MW: 22113.9 Da    PI: 8.3994
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
30131.m007102genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702176.89.7e-5591384153
         DUF702   4 gtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssaeskke 99 
                    g+++CqdCGnqakkdC+++RCRtCCks+gf+C+thvkstWvpa++r++r q+ ++ + ++++   +++ +++++            +       ++
  30131.m007102   9 GGSRCQDCGNQAKKDCVYMRCRTCCKSKGFHCQTHVKSTWVPAYRRQQRLQNVSSIQLQQQH--PQDQLHNPKR-----------LR-------EN 84 
                    7789*********************************************8888776544422..1222222221...........11.......22 PP

         DUF702 100 letsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGle 153
                      t+++P+ev+s a frc+rvss+d+g++++aYqt++sigGhvfkGiLydqG+ 
  30131.m007102  85 PATENFPAEVNSLATFRCLRVSSIDEGDDQFAYQTSMSIGGHVFKGILYDQGPT 138
                    34678***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051422.2E-5510137IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016235.5E-291354IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.1E-2590137IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MMMRQGGLGG SRCQDCGNQA KKDCVYMRCR TCCKSKGFHC QTHVKSTWVP AYRRQQRLQN  60
VSSIQLQQQH PQDQLHNPKR LRENPATENF PAEVNSLATF RCLRVSSIDE GDDQFAYQTS  120
MSIGGHVFKG ILYDQGPTYT IGESSTTQIQ EPNLANAAAL TSTTLAPTSS VDADSLPPSY  180
PFPFNAFMSG TQLFLHPKS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002512967.11e-150PREDICTED: protein SHI RELATED SEQUENCE 1
SwissprotQ9SD403e-59SRS1_ARATH; Protein SHI RELATED SEQUENCE 1
TrEMBLB9RHA81e-150B9RHA8_RICCO; Putative uncharacterized protein
STRINGPOPTR_0009s12450.15e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF99692541
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75520.13e-54SHI-related sequence 5